What's the word for killing your sister?

I Survived The War But We Lost My Sister

Best Answer

Parricide, the killing of one's parents or another close relative.

Patricide, the killing of one's father.

Prolicide, is the killing of one's offspring.

Sororicide, the killing of one's sister.

Pinay found guilty of killing pregnant sister-in-law in Las Vegas

Previous QuestionHow much do you have to weigh to start your period?
Next QuestionCan obesity stop puberty?

Related Questions

What state can you marry your sister?

Laws regarding first-cousin marriage in the United States StateFirst cousin marriage allowedAdopted-cousin marriage allowedAlabamaYesYesAlaskaYesYesArizonaOnly if both parties are 65 or older, or one is infertileYesArkansasNoUnknown44 autres lignes

Can you marry your sister?

Sibling marriage and avunculate marriage is prohibited, while cousin marriage is legal. Marriage between parents and offspring is also prohibited, even when there is no blood relationship, i.e. adoptive parent or parent-in-law.

What is the Scottish word for dog?

Loch – the Scottish Gaelic word for a lake. Haggis – a traditional Scottish dish.

Man kills wife, her sister and himself in Delray Beach

What is the Viking word for dog?

He is one of the most intimidating figures in Norse mythology taking part in Ragnarok, the destruction of the world. Fenrir is a great name for any giant breed dog, particularly one used for protection. It could also be a great name for a dog that looks like a wolf, like an Alaskan Malamute or Alsatian Shepherd.

What is the Sioux word for dog?

ROSEBUD — Long before they became a horse-and-buffalo society centuries ago, the Lakota and Dakota people used to rely heavily on another animal for their daily existence. Sunka (SHOON-kuh), they called them — Lakota for "dog."

What is the Norse word for wolf?

In Norse mythology, a vargr (pl. vargar; often anglicised as warg or varg) is a wolf and in particular refers to the wolf Fenrir and the wolves that chase the sun and moon Sköll and Hati.

What is the word for horse meat?

Sakura is the Japanese word for raw horse meat, and baniku can mean horse meat as well.

What does the word s * * * * * * mean?

Shit is a word generally considered to be vulgar and profane in Modern English. As a noun, it refers to fecal matter, and as a verb it means to defecate; in the plural ("the shits"), it means diarrhoea. Shite is a common variant in British and Irish English.

911 Call After 13-Year-Old Boy Kills Sister: ‘I Feel So Messed Up’

What is the word for willing to do anything?

Synonyms of willing. amenable, disposed, fain, game, glad, inclined, minded, ready. Words Related to willing. predisposed, prone. accommodating, agreeable, compliant, cooperative, obedient, obliging, submissive.

What's another word for puppy?

puppy animal. dog. pup. canine. coxcomb. dandy. fop. whelp.

What disease does the sister have in Pet Sematary?

(It is explained later that Rachel was traumatized by the early death of her sister, Zelda, from spinal meningitis—an issue that is brought up several times in flashbacks.

What does the word the mean?

Mean is one of those ordinary, everyday words with lots of different meanings. The adjective mean can describe someone who's stingy or ungenerous, but it also means "unkind or unfair," which is what a little kid intends to convey when she yells at her mother, "You're mean!"

Is the S word a bad word?

Profanity means swear words. The adjective is 'profane'. Profanities can also be called curse ("cuss") words, dirty words, bad words, foul language, obscenity, obscene language, or expletives. It can be called swearing, although this also has a normal meaning of making a "solemn promise".

911 call: Teen admits to killing sister, mother

What is another word for canine?

hound, puppy, canine, mongrel, cur, canis familiaris (Latin), bitch, pup, whelp, stray, watchdog, lap dog, guide dog, Seeing Eye dog, pye-dog, pooch*, mutt*, bowwow*, Fido*, fleabag*.

What is another word for puppies?

puppy animal. dog. pup. canine. coxcomb. dandy. fop. whelp.

What words have Z at the end?

3 Letter Words adz. bez. biz. caz. coz. cuz. fez. fiz.

What rhymes with the word sit?

Rhymes with Sit 29 One-Syllable Rhymes of Sit. bitbritchitfitflitgrithititkitknitlitmitmittnitpitquitsitskitslitspitsplitspritteattittwitwhitwitwritzit. 43 Two-Syllable Rhymes of Sit. 8 Three-Syllable Rhymes of Sit.

What is another word for cow poop?

Cow dung, also known as cow pats, cow pies or cow manure, is the waste product of bovine animal species. These species include domestic cattle ("cows"), bison ("buffalo"), yak, and water buffalo. Cow dung is the undigested residue of plant matter which has passed through the animal's gut.

What's another word for pet peeve?

irritate, exasperate, nettle, provoke, rile, peeve mean to excite a feeling of anger or annoyance. irritate implies an often gradual arousing of angry feelings that may range from mere impatience to rage. exasperate suggests galling annoyance and the arousing of extreme impatience.

What's another word for a female dog?

Unfortunately, the word "bitch" has impolite connotations, so I'd rather not use it, but I'm not sure of any other terms for a female dog. Likewise, I don't know of a gendered term for a a male dog, apart from 'dog'.

What disease did the sister have in Pet Sematary?

(It is explained later that Rachel was traumatized by the early death of her sister, Zelda, from spinal meningitis—an issue that is brought up several times in flashbacks.

What are some Z words for Scrabble?

OSPD 3- to 5-Letter Words With a Z in the Official Scrabble Players Dictionary (as of 2-Mar-98) These are the 4-letter words which include the letter Z:ADZEDAZELAZEAZANDITZLAZYAZONDOZELUTZBIZEDOZYMAZE6 autres lignes • 14 déc. 2012

What is another word for puppy?

puppy animal. dog. pup. canine. coxcomb. dandy. fop. whelp.

What is the most offensive word?

The word cunt is generally regarded in English-speaking countries as unsuitable for normal public discourse. It has been described as "the most heavily tabooed word of all English words", although John Ayto, editor of the Oxford Dictionary of Slang, says "nigger" is more taboo.

What does the word Calle mean?

Calle means "street" in Spanish and Venetian.

What was the first curse word?

In other "damn" related information, "god-damn" was used in the late 14th century, according to OED. It came from the Old French word godon, which was apparently "a term of reproach applied to the English by the French." Salty. Additionally, the euphemism "dang" was first used around 1780.

What words are repeated in The Raven?

In Poe's 18-stanza poem, “The Raven,” the line, “Quoth the Raven, Nevermore,” comes in toward the middle and gets repeated, or the word “nevermore” gets repeated, in the subsequent stanzas.

What is the fear of short words?

The word itself comes from the Greek word phobos, which means fear or horror. Hydrophobia, for example, literally translates to fear of water. When someone has a phobia, they experience intense fear of a certain object or situation. Phobias are a type of anxiety disorder. Anxiety disorders are very common.

What does the D word mean?

The D-Word. The name "D-Word" is defined as "industry euphemism for documentary", as in: "We love your film but we don't know how to sell it. It's a d-word."

What literary device uses the word like?

A simile is a figure of speech that makes a comparison, showing similarities between two different things. Unlike a metaphor, a simile draws resemblance with the help of the words “like” or “as.” Therefore, it is a direct comparison. We can find simile examples in our daily speech.

What words have J at the end?

List of all words that ends with the letter j. 3 Letter Words. haj. raj. taj. Disclaimer. 4 Letter Words. benj. hadj. hajj. 5 Letter Words. aflaj. falaj. 6 Letter Words. svaraj. swaraj.

What words have J in the middle?

Scrabble Guru 4-Letter Words. ajar. ajee. baju. djin. dojo. fuji. gajo. gjus. haji. hajj. juju. koji. mojo. puja. raja. roji. sijo. sjoe. soja. 5-Letter Words. ajiva. ajuga. ajwan. bajan. bajra. bajri. bajus. banjo. bhaji. bijou. bunje. bunjy. cajon. cajun. djinn. djins. dojos. eejit. eject. enjoy. fjeld. fjord. fujis. gadje. gadjo. gajos. ganja. gauje. hadji. hajes. hajis. hajji.

What does the word B * * * * mean?

Bitch, literally meaning a female dog, is a pejorative slang word for a person—usually a woman—who is belligerent, unreasonable, malicious, a control freak, rudely intrusive or aggressive. When applied to a man, bitch is a derogatory term for a subordinate.

What is the Japanese word of mother?

Haha – “Mother”; Okaasan – Someone Else's Mother. Pay attention to which Japanese vocabulary word you use in which circumstance. When you're talking about another person's mother, it's disrespectful (and rude) to call them haha (はは).

What is the oldest swear word?

Fart, as it turns out, is one of the oldest rude words we have in the language: Its first record pops up in roughly 1250, meaning that if you were to travel 800 years back in time just to let one rip, everyone would at least be able to agree upon what that should be called.

What does the word Zuma mean?

The name Zuma is of Aztec origin and means "Lord Frowns In Anger." The origin is the culture in which the name originated, or in the case of a word--the language in which it most appears. Short form of Moctezuma or Montezuma, a Nahuatl surname. Moctezuma I, fifth Aztec emperor. Zuma Beach, California.

What kills your appetite?

Natural appetite suppressants Eat more protein and healthful fats. Eating foods rich in protein or fat can reduce hunger cravings and suppress appetite. Drink water before every meal. Eat more high-fiber foods. Exercise before a meal. Drink Yerba Maté tea. Switch to dark chocolate. Eat some ginger. Eat bulky, low-calorie foods.

Where are the kimono sisters in Heartgold?

In Pokémon Gold, Silver, and Crystal, five Kimono Girls live in Ecruteak City, and can be battled at the Ecruteak Dance Theater. Each owns one of the five Eeveelutions available in Generation II.

What sorority is sister to Kappas?

In the NPHC, there is one official brother/sister arrangement: Zeta Phi Beta and Phi Beta Sigma.

What is the most popular word in the world?

There are several possibilities for the most common word in the world: the, hello, chocolate, Coca-Cola and louse.

What book of the Bible has the most words?

There are 260 chapters in the New Testament. This gives a total of 1,189 chapters (on average, 18 per book). Psalm 117, the shortest chapter, is also the middle chapter of the Bible, being the 595th Chapter. Psalm 119 is the longest chapter of the Bible.

What is the most versatile word in the English language?

The word 'fuck' is supposedly one of the most vulgar in the English language. It is also one of the most used, not to mention one of the most versatile.

How many words does your dog know?

But if you have the motivation and patience, you will probably be able to teach your dog even more than 100 words. Stanley Coren, a psychologist who has performed a significant amount of research on the subject of dog intelligence, suggests that average trained dogs know about 160 words [source: Coren].

Who invented the word cat?

The origin of the English word cat (Old English catt) and its counterparts in other Germanic languages (such as German Katze), descended from Proto-Germanic *kattōn-, is controversial.

Who is the sister sorority to Omega Psi Phi?

Not constitutionally. But Omega does enjoy a great historical connection to The Delta Sigma Theta Sorority -- a "special bond" known today as Coleman Love. Delta Founders Edna Brown and Edith Young were the college sweethearts of Omega Founders Frank Coleman and Edgar Love, respectively.

Who is the sister sorority of Omega Psi Phi?

Not constitutionally. But Omega does enjoy a great historical connection to The Delta Sigma Theta Sorority -- a "special bond" known today as Coleman Love. Delta Founders Edna Brown and Edith Young were the college sweethearts of Omega Founders Frank Coleman and Edgar Love, respectively.

Who invented the word hamburger?

The exact origin of the hamburger may never be known with any certainty. Most historians believe that it was invented by a cook who placed a Hamburg steak between two slices of bread in a small town in Texas, and others credit the founder of White Castle for developing the "Hamburger Sandwich."

Who created the word dog?

One needs to look deeper to find where “dog” comes from. Today, the most popular theory is that “dog” is derived from another Old Germanic word – “docga” (dogga). This word was used to refer to a powerful breed of canine, and it is believed that its root is the word “dukkōn”, meaning “power, strength”.

Whats the worst vegetable for your gut?

The Best (and Worst) Foods for Your Gut Kimchi. This fermented cabbage Korean staple is rich in two classes of good bacteria associated with better gut health (they're called Lactobacillus and Bifidobacterium if you want to get technical). Yogurt. Jerusalem Artichokes. Garlic. Green (Unripe) Bananas. Barley. Apples. Shirataki Noodles.

Is the word saint in the Bible?

The English word "saint" comes from the Latin "sanctus". The word translated in Greek is "ἅγιος" (hagios), which means "holy". The word ἅγιος appears 229 times in the Greek New Testament, and its English translation 60 times in the corresponding text of the King James Version of the Bible.

What is a word for a poor person?

indigent, impoverished, impecunious, destitute, needy, necessitous, penniless, poverty-stricken, underprivileged, disadvantaged, deprived, starved, starving, straitened, penurious, pinched, distressed, in reduced circumstances, beggared, famine-stricken, underdeveloped, empty-handed, insolvent, beggarly, ill-provided,

What words have Z?

OSPD 3- to 5-Letter Words With a Z in the Official Scrabble Players Dictionary (as of 2-Mar-98) These are the 4-letter words which include the letter Z:ADZEDAZELAZEAZANDITZLAZYAZONDOZELUTZBIZEDOZYMAZE6 autres lignes • 14 déc. 2012

What does the word Nina mean in Spanish?

Nina is a feminine name with unclear etymology. The name Nina may originate from the old Slavic word Ninati, meaning "dreamer" or "dream". Other origins for the name Nina include - Serbian, Native American, Spanish, English, Croatian, and Indian.

What does the word heel mean in dog training?

The command or skill "heel" simply means that the dog must walk directly next to you instead of behind or in front of you. The dog is required to keep pace with you, only stopping when you stop and walking when you walk.

What happens when brother and sister dogs breed?

When siblings mate, new genetic defects may present in their offspring. When two dogs born in the same litter mate, the likelihood that their offspring will have the same traits they have. This is why breeders sometimes interbreed their dogs -- it enables them to better predict things like appearance and temperament.

What happens when you breed brother and sister dogs?

When siblings mate, new genetic defects may present in their offspring. When two dogs born in the same litter mate, the likelihood that their offspring will have the same traits they have. However, it can also increase the offspring's risk of disease or disability, too.

What is the charge for accidentally killing someone?

It occurs when someone kills, without intent, in the course of committing an unlawful act. The malice involved in the crime is transferred to the killing, resulting in a charge of manslaughter. Involuntary manslaughter may be distinguished from accidental death.

What is the best dog for killing rats?

Top 10 Dog Breeds Ideal for Catching Rats Top 10 Dog Breeds Ideal for Catching Rats. Rat Terrier. Rat Terrier | Source. Cairn Terrier. Cairn Terrier | Source. Yorkshire Terrier. Yorkshire Terrier | Source. Norfolk Terrier. Norfolk Terrier | Source. Jack Russell Terrier. Jack Russell Terrier | Source. West Highland White Terrier. Lakeland Terrier.

What is the punishment for killing an animal?

Acts of cruelty against animals can be punished with imprisonment, for a minimum of three months up to a maximum of three years, and with a fine ranging from a minimum of 3,000 Euros to a maximum of 160,000 Euros, as for the law n°189/2004.

What is the penalty for killing a dog?

Cruelty to a dog or cat is a Class A Misdemeanor, punishable with a fine of up to $1,000 and/or imprisonment up to 6 months. Intentionally torturing a dog or cat is a Class C Felony punishable with a fine of up to $5,000 and/or imprisonment up to 10 years.

What is the slow kill method for heartworms?

Monthly administration of ivermectin-based heartworm preventive medications alone is sometimes used as a second method of heartworm treatment. This is referred to as the "slow kill" or "soft kill" method.

What happens if you kill your dog?

Dogs, cats, and other animals are treated like property under the law. They could also face criminal charges, including animal cruelty or criminal property damage. But there are exceptions—certain circumstances when people have the legal right to kill a dog.

Where is the word dog from?

One needs to look deeper to find where “dog” comes from. Today, the most popular theory is that “dog” is derived from another Old Germanic word – “docga” (dogga). This word was used to refer to a powerful breed of canine, and it is believed that its root is the word “dukkōn”, meaning “power, strength”.

Was the word God or a god?

In the beginning was the Word, and the Word was with God, and the Word was God. According to Matthew Henry (1662–1714) in his commentary, Jesus is called the "Word" in this opening verse because he was the Son of God sent to earth to reveal his Father's mind to the world.

Where did the word dog come from?

Most linguists search the origin for the word “dog” in the Old Germanic language, which has spawned many modern English words. But still – in Germany the general term for dog is “hund”, and “hound” is a cognate of this word. One needs to look deeper to find where “dog” comes from.

Where did the word hush puppies originate?

They were created by a group of Ursuline nuns who had come from France. The nuns converted cornmeal into a delicious food that they named croquettes de maise. The making of these croquettes spread rapidly through the southern states. An African cook in Atlanta is said to have given the name hushpuppy to this food.

Where is the visual word form area?

The visual word form area (VWFA) is a functional region of the left fusiform gyrus and surrounding cortex (right-hand side being part of the fusiform face area) that is hypothesized to be involved in identifying words and letters from lower-level shape images, prior to association with phonology or semantics.

What kills hookworms in your yard?

The IFAS reports that borax, also known as boric acid, can be used as a soil treatment for hookworms. In its dried form, borax can be sprinkled on the ground to kill hookworm eggs or larvae in the soil.

What words end with IX?

8-letter words that end in ix appendix. crucifix. intermix. aviatrix. cicatrix. transfix. coturnix. mirepoix.

What word rhymes with Else?

Near rhymes with Else Word1elfDefinition2myselfDefinition3itselfDefinition4hisselfDefinition95 weitere Zeilen

What word rhymes with socks?

Words That Rhyme With Sock 1 Syllable Words That Rhyme With Sock. Bach. Back. Beck. Black. Bloc. Bloch. Block. 2 Syllable Words That Rhyme With Sock. Aback. Alack. Alcock. Amuck. Attack. Ballcock. Bangkok. 3 Syllable Words That Rhyme With Sock. Aftershock. Antiknock. Antilock. Hammerlock. Hollyhock. Interlock. Isaak. 4 Syllable Words That Rhyme With Sock. Electroshock.

What word rhymes with hat?

Rhymes with Hat atbatbattbratcatchatdratfatflatgnathatmatmattmattepatplatratsatscatscattskatslatspatsplatspratstattatthatvat. begatbobcatbrickbatchitchatcombatcravatdefatdingbatdoormatformathellcathepcathousesatjuratlandsatmuscatmuskratnonfatpolecatthereattomcatwhereatwildcatwombat.

What word rhymes with rock?

Words That Rhyme With Rock 1 Syllable Words That Rhyme With Rock. Bach. Back. Beck. Black. Bloc. Bloch. Block. 2 Syllable Words That Rhyme With Rock. Aback. Alack. Alcock. Amuck. Attack. Ballcock. Bangkok. 3 Syllable Words That Rhyme With Rock. Aftershock. Antiknock. Antilock. Hammerlock. Hollyhock. Interlock. Isaak. 4 Syllable Words That Rhyme With Rock. Electroshock.

What word rhymes with tall?

Rhymes with Tall 36 One-Syllable Rhymes of Tall. allawlballbawlbrawlcallcrawldolldrawldrollfallgallgaulgaullehaulkraalmallmaulmollpallpaulpawlsaulscrawlshawlsmallsolspallsprawlsquallstalltallthralltrawlwallyawl. 55 Two-Syllable Rhymes of Tall. 29 Three-Syllable Rhymes of Tall. 2 Four-Syllable Rhymes of Tall. 1 Five-Syllable Rhymes of Tall.

What word rhymes with mule?

Rhymes with Mule 17 One-Syllable Rhymes of Mule. coolcrueldroolfoolfuelghoulgruelmewlmulepoolruleschoolspoolstooltoolyou'llyule. 24 Two-Syllable Rhymes of Mule. 9 Three-Syllable Rhymes of Mule.

What words rhyme with balls?

Words That Rhyme With Balls 1 Syllable Words That Rhyme With Balls. Alls. Bells. Bills. Brawls. Bulls. Calls. Cells. Chills. 2 Syllable Words That Rhyme With Balls. Appalls. Atolls. Befalls. Bluebells. Bookstalls. Braincells. Catcalls. Doorbells. 3 Syllable Words That Rhyme With Balls. Baseballs. Basketballs. Cannonballs. Coveralls. Eyeballs. Farewells. Fireballs.

What word rhymes with flute?

Rhymes with Flute 26 One-Syllable Rhymes of Flute. beautbootbrutbrutebuttechutecootcuteflutefruithootjuteknoutlootlutemootmuterootroutescootshootsnootsootsuittootute. 41 Two-Syllable Rhymes of Flute. 29 Three-Syllable Rhymes of Flute. 4 Four-Syllable Rhymes of Flute.

What word rhymes with cup?

Words That Rhyme With Cup 1 Syllable Words That Rhyme With Cup. Coup. Krupp. Pup. Soup. Stupp. Sup. Up. Yup. 2 Syllable Words That Rhyme With Cup. Closeup. Workup.

What words cause Iphone effects?

9 GIFs Showcasing Every New iMessage Bubble Effect in iOS 10 Slam. The Slam effect aggressively plops your message on screen and even shakes the previous conversation bubbles for effect. Loud. Gentle. Invisible Ink. Balloons. Confetti. Lasers. Fireworks.

What is knowledge simple words?

Knowledge means the things which are true, as opposed to opinion. Information which is correct is knowledge. Knowledge can refer to a theoretical or practical understanding of a subject. This was the point of Ryle's distinction between "knowing that" and "knowing how".

What happens if someone kills your dog?

File a police report. You should also call the police and report whoever injured or killed your pet. It is a crime if someone intentionally kills your animal, so always call the police if someone intentionally kills your pet. In most states, the prosecutor will charge the defendant with animal cruelty.

What happens if a brother and sister have a kid?

If a brother and sister, assuming they have the same birth parents, had a child together, then their offspring have a 50% chance of inheriting a genetic defect because both parents have a 25% change of being a carrier of a defective gene they received from either of their parents.

What happens if a brother and sister dog have puppies?

When siblings mate, new genetic defects may present in their offspring. When two dogs born in the same litter mate, the likelihood that their offspring will have the same traits they have. However, it can also increase the offspring's risk of disease or disability, too.

Is pooch another word for dog?

Words Related to pooch cur, mongrel, mutt. lapdog, pup, puppy, puppy dog, whelp. bandog, bird dog, coonhound, courser, gundog, hunter, sheepdog, sled dog, watchdog, wolf dog, wolfhound. guide dog, police dog, working dog.

Is there a word for male dog?

In the breeder's world, a male dog is simply called a "dog." (Females are called "bitches.") In the breed ring you have classes for "dogs" and classes for "bitches." Only males show as dogs, and only females show as bitches.

What words end in EZ?

3-letter words that end in ez fez. lez. sez. mez. kez. rez. pez. nez.

What words do dogs understand?

According to experts, intelligent dogs can learn around 165 words. But spoken language isn't the only means by which our dogs try to understand us. Dr. Stanley Coren, a psychologist and an expert on dog intelligence, says the average trained dog knows about 165 words.

What word rhymes with frog?

'frog' may also rhyme with: blog. · bog. · clague. · clog. · dague. · flog. · fog. · fogg. · frogg. · frogge… hog · dialog. hedgehog. · sledgedog. · log. · how many chucks could a wood chuck chuck if a wood chuck could chuck wood? blog. · bog. · clog. · cog. · dog. · fog. · hog. · jog. · log. · smog…

What word rhymes with clock?

Words That Rhyme With Clock 1 Syllable Words That Rhyme With Clock. Bach. Bloc. Bloch. Block. Blok. Bock. Bok. 2 Syllable Words That Rhyme With Clock. Airlock. Alcock. Ballcock. Bangkok. Bedrock. Bloodstock. 3 Syllable Words That Rhyme With Clock. Aftershock. Antiknock. Antilock. Chockablock. Forelock. Hammerlock. 4 Syllable Words That Rhyme With Clock. Electroshock.

What word rhymes with ring?

Words that rhyme with "ring": 1 syllable: bing, ching, cling, ding, fling, ging, hing, ing, jing, king, kling, ling, lyng, ming, ning, ping, qing, schwing, shing, sing, singh, sling, sting, swing, thing, thwing, ting, tinge, wing, ying, zing. 2 syllables: beijing, chongqing, outsing, peking, unsling, upswing, xiaoping. Show Rare Words: Yes | No.

What word rhymes with pan?

Words That Rhyme With Pan 1 Syllable Words That Rhyme With Pan. An. Ann. Anne. Ban. Bann. Bean. 2 Syllable Words That Rhyme With Pan. Began. Bhutan. Cezanne. Chapin. Chauvin. Cheyenne. 3 Syllable Words That Rhyme With Pan. Anchorman. Ariane. Bogeyman. Boogeyman. Caravan. 4 Syllable Words That Rhyme With Pan. Assemblyman. Businessman. Catamaran. Minuteman. Newspaperman.

What word rhymes with map?

Rhymes with Map 23 One-Syllable Rhymes of Map. capchapclapcrapflapgaplaplappmapnapnapepaprapsapscrapslapsnapstraptaptrapwrapyapzap. 35 Two-Syllable Rhymes of Map. 5 Three-Syllable Rhymes of Map.

What word rhymes with milk?

What rhymes with "milk": bilk, ilk, silk, wilk, buttermilk, mi Pure Rhymes – 4 rhymes. bilk ilk silk wilk. End Rhymes – 1 rhyme. buttermilk. End Rhymes Set #1 of 1 (Add to/Edit Set Members) Near Rhymes – 2199 rhymes. milks silks. Dilks Wilkes. bilked milked. Near Rhymes Set #2 of 84 (Add to/Edit Set Members)

What word rhymes with block?

Rhymes with Block 40 One-Syllable Rhymes of Block. bachbalkblocblockbockcalkcaulkchalkchockclockcockcrockdocdockflocflockfrockgawkhawkhochockjockknocklocklockemachmockpockrockschlockshocksmocksocksquawkstalkstocktalkwalkwokyak. 77 Two-Syllable Rhymes of Block. 14 Three-Syllable Rhymes of Block. 1 Four-Syllable Rhymes of Block.

What word rhymes with rat?

Rhymes with Rat 29 One-Syllable Rhymes of Rat. atbatbattbratcatchatdratfatflatgnathatmatmattmattepatplatratsatscatscattskatslatspatsplatspratstattatthatvat. 24 Two-Syllable Rhymes of Rat. 21 Three-Syllable Rhymes of Rat. 2 Four-Syllable Rhymes of Rat. 1 Five-Syllable Rhymes of Rat.

What word rhymes with meat?

Rhymes with Meat 31 One-Syllable Rhymes of Meat. beatbeetbleatcheatcleatcreteeatfeatfeetfetefleetgreetheatmeatmeetmeteneatpeatpetepleatseatsheetskeetsleetstreetsuitesweetteattreattweetwheat. 55 Two-Syllable Rhymes of Meat. 15 Three-Syllable Rhymes of Meat.

What word rhymes with weak?

Rhymes with Weak 34 One-Syllable Rhymes of Weak. beakbleakcheekchiccliquecreakcreekekefreakgeekgleekgreekleakleekmeekpeakpeekpiquereekseeksheiksheikhshrieksikhsleeksneakspeaksqueakstreakteaktweakweakweekwreak. 18 Two-Syllable Rhymes of Weak. 4 Three-Syllable Rhymes of Weak. 1 Five-Syllable Rhymes of Weak.

What word rhymes with legs?

Words That Rhyme With Leg 1 Syllable Words That Rhyme With Leg. Beg. Cleg. Clegg. Eg. Egg. Gegg. Greg. Gregg. Keg. Kreg. Legge. Meg. Neg. Peg. Pegg. Preg. Reg. Veg. 2 Syllable Words That Rhyme With Leg. Manege. Muskeg. Segue.

Is the word good derived from God?

Ironically, given your question, the form our modern English adjective and noun “good” took in Old English was the spelling “god” (although it was pronounced with a long “o”). “Devil” arrived in Old English as “deofol,” meaning “spirit of evil,” drawn from the Greek word “diabolos,” which also gave us “diabolical.”

Where did the words * * * come from?

Even the Oxford English Dictionary throws its hands up and admits “of the actual origin we have no evidence.” But, the OED continues, “the forms dada and tata, meaning 'father,' originating in infantile or childish speech, occur independently in many languages.” In other words, “dad” might come from baby talk.