What word rhymes with clock?

Nursery Rhyme - The Clock Song

Best Answer
Words That Rhyme With Clock
  • 1 Syllable Words That Rhyme With Clock. Bach. Bloc. Bloch. Block. Blok. Bock. Bok.
  • 2 Syllable Words That Rhyme With Clock. Airlock. Alcock. Ballcock. Bangkok. Bedrock. Bloodstock.
  • 3 Syllable Words That Rhyme With Clock. Aftershock. Antiknock. Antilock. Chockablock. Forelock. Hammerlock.
  • 4 Syllable Words That Rhyme With Clock. Electroshock.

Hickory Dickory Dock | CoCoMelon Nursery Rhymes & Kids Songs

Previous QuestionWhat word rhymes with rock?
Next QuestionWhat word rhymes with ring?

Related Questions

What word rhymes with ball?

Words That Rhyme With Ball 1 Syllable Words That Rhyme With Ball. All. Aul. Awl. Bawl. Bell. Bill. 2 Syllable Words That Rhyme With Ball. Angell. Appall. Atoll. Bacall. Befall. Befell. 3 Syllable Words That Rhyme With Ball. Baseball. Basketball. Buckyball. Butterball. Cannonball. Cortisol. 4 Syllable Words That Rhyme With Ball. Cholesterol. Ergosterol. Wherewithal.

What word rhymes with huge?

Rhymes with Huge 5 One-Syllable Rhymes of Huge. hugerougescroogescrougestooge. 2 Two-Syllable Rhymes of Huge. delugerefuge. 2 Three-Syllable Rhymes of Huge. centrifugesubterfuge.

What word rhymes with use?

Words That Rhyme With Use 1 Syllable Words That Rhyme With Use. Apse. Base. Boose. Broose. Bruce. Case. Coos. 2 Syllable Words That Rhyme With Use. Abstruse. Abuse. Adduce. Burnoose. Caboose. Conduce. 3 Syllable Words That Rhyme With Use. Calaboose. Disabuse. Introduce. Outproduce. Reintroduce. Reproduce. 4 Syllable Words That Rhyme With Use. Catafalques. Overproduce.

The Clock - Nursery Rhyme

What word rhymes with way?

Rhymes with Way 43 One-Syllable Rhymes of Way. aayebaybrayclaydaydrayfayflayfraygaygraygreyhayheyjaylaymaemaynayneighpayplaypraypreyquayraysayshayslaysleighspaysplayspraystaystrayswaytheytraywayweighwheyyea. 204 Two-Syllable Rhymes of Way. 100 Three-Syllable Rhymes of Way. 7 Four-Syllable Rhymes of Way. 1 Six-or-More Syllable Rhymes of Way.

What word rhymes with rug?

Words that rhyme with "rug": 1 syllable: bug, bugg, bugge, chug, doug, dug, fug, hug, hugg, jug, klug, lug, mug, plug, pug, schug, slug, smug, snug, sugg, thug, tug, ugh. 2 syllables: debug, unplug. Show Rare Words: Yes | No. Show Phrases: Yes | No.

What word rhymes with rules?

Near rhymes with Rule Word4coolDefinition5foolDefinition6fuelDefinition7poolDefinition95 weitere Zeilen

What word rhymes with ham?

Rhymes with Ham 25 One-Syllable Rhymes of Ham. amcamclamcramdamdamndramgramhamhammjamjamblambma'ampramramsamscamscramshamslamswamtramwhamyam. 16 Two-Syllable Rhymes of Ham. 39 Three-Syllable Rhymes of Ham. 8 Four-Syllable Rhymes of Ham. 1 Five-Syllable Rhymes of Ham.

What word rhymes with feet?

Words That Rhyme With Feet 1 Syllable Words That Rhyme With Feet. Beat. Beet. Bet. Bleat. Cheat. Cleat. Crete. Diet. Duet. Eat. 2 Syllable Words That Rhyme With Feet. Abet. Amit. Anklet. Applet. Armlet. Asset. Backseat. Ballet. Basket. Basset. 3 Syllable Words That Rhyme With Feet. Amulet. Bittersweet. Eyelet. Forefeet. Incomplete. Indiscreet. Loveseat. Marguerite. Obsolete.

There's a Neat Little Clock | Animated Nursery Rhyme in English

What word rhymes with bug?

Words That Rhyme With Bug 1 Syllable Words That Rhyme With Bug. Chug. Doug. Drug. Dug. Fug. Hug. Jug. Klug. Krug. Lug. Mug. Plug. Pug. Rug. Rugg. Schug. Shrug. Slug. Smug. Snug. Sugg. 2 Syllable Words That Rhyme With Bug. Debug. Hearthrug. Unplug. 3 Syllable Words That Rhyme With Bug. Antidrug. Doodlebug. Firebug. Fireplug. Jitterbug. Ladybug. Litterbug. Mealybug. Shutterbug.

What word rhymes with CAP?

Rhymes with Cap 23 One-Syllable Rhymes of Cap. capchapclapcrapflapgaplaplappmapnapnapepaprapsapscrapslapsnapstraptaptrapwrapyapzap. 35 Two-Syllable Rhymes of Cap. 5 Three-Syllable Rhymes of Cap.

What word rhymes with rope?

What rhymes with "rope": cope, dope, grope, hope, lope, mope,

What word rhymes with small?

Words That Rhyme With Small 1 Syllable Words That Rhyme With Small. All. Aul. Awl. Ball. Bawl. Brawl. 2 Syllable Words That Rhyme With Small. Appall. Bacall. Befall. Blackball. Bookstall. Bradawl. 3 Syllable Words That Rhyme With Small. Baseball. Basketball. Buckyball. Butterball. Cannonball. 4 Syllable Words That Rhyme With Small. Cholesterol. Ergosterol. Wherewithal.

What word rhymes with fish?

Words that rhyme with "fish": 1 syllable: bisch, bish, blish, cuish, disch, dish, frisch, gish, isch, ish, kisch, kish, klish, knish, krisch, lish, misch, mish, risch, rish, squish, swish, tisch, tish, trish, whish, wisch, wish, wisz. 2 syllables: demisch, ladish, mcclish, mclish, mcnish, unwish. Show Rare Words: Yes | No. Show Phrases: Yes | No.

Tick Tock Tick Tock Merrily Sings The Clock

What word rhymes with pin?

Rhymes with Pin 23 One-Syllable Rhymes of Pin. beenbinchindinfinfinngingrinininnjinnkinpinshinsinskinspinthintintwinwinyinzinn. 52 Two-Syllable Rhymes of Pin. 12 Three-Syllable Rhymes of Pin. 3 Four-Syllable Rhymes of Pin. 1 Six-or-More Syllable Rhymes of Pin.

What word rhymes with Else?

Near rhymes with Else Word1elfDefinition2myselfDefinition3itselfDefinition4hisselfDefinition95 weitere Zeilen

What word rhymes with socks?

Words That Rhyme With Sock 1 Syllable Words That Rhyme With Sock. Bach. Back. Beck. Black. Bloc. Bloch. Block. 2 Syllable Words That Rhyme With Sock. Aback. Alack. Alcock. Amuck. Attack. Ballcock. Bangkok. 3 Syllable Words That Rhyme With Sock. Aftershock. Antiknock. Antilock. Hammerlock. Hollyhock. Interlock. Isaak. 4 Syllable Words That Rhyme With Sock. Electroshock.

What word rhymes with hat?

Rhymes with Hat atbatbattbratcatchatdratfatflatgnathatmatmattmattepatplatratsatscatscattskatslatspatsplatspratstattatthatvat. begatbobcatbrickbatchitchatcombatcravatdefatdingbatdoormatformathellcathepcathousesatjuratlandsatmuscatmuskratnonfatpolecatthereattomcatwhereatwildcatwombat.

What word rhymes with rock?

Words That Rhyme With Rock 1 Syllable Words That Rhyme With Rock. Bach. Back. Beck. Black. Bloc. Bloch. Block. 2 Syllable Words That Rhyme With Rock. Aback. Alack. Alcock. Amuck. Attack. Ballcock. Bangkok. 3 Syllable Words That Rhyme With Rock. Aftershock. Antiknock. Antilock. Hammerlock. Hollyhock. Interlock. Isaak. 4 Syllable Words That Rhyme With Rock. Electroshock.

What word rhymes with tall?

Rhymes with Tall 36 One-Syllable Rhymes of Tall. allawlballbawlbrawlcallcrawldolldrawldrollfallgallgaulgaullehaulkraalmallmaulmollpallpaulpawlsaulscrawlshawlsmallsolspallsprawlsquallstalltallthralltrawlwallyawl. 55 Two-Syllable Rhymes of Tall. 29 Three-Syllable Rhymes of Tall. 2 Four-Syllable Rhymes of Tall. 1 Five-Syllable Rhymes of Tall.

What word rhymes with mule?

Rhymes with Mule 17 One-Syllable Rhymes of Mule. coolcrueldroolfoolfuelghoulgruelmewlmulepoolruleschoolspoolstooltoolyou'llyule. 24 Two-Syllable Rhymes of Mule. 9 Three-Syllable Rhymes of Mule.

What words rhyme with balls?

Words That Rhyme With Balls 1 Syllable Words That Rhyme With Balls. Alls. Bells. Bills. Brawls. Bulls. Calls. Cells. Chills. 2 Syllable Words That Rhyme With Balls. Appalls. Atolls. Befalls. Bluebells. Bookstalls. Braincells. Catcalls. Doorbells. 3 Syllable Words That Rhyme With Balls. Baseballs. Basketballs. Cannonballs. Coveralls. Eyeballs. Farewells. Fireballs.

What word rhymes with flute?

Rhymes with Flute 26 One-Syllable Rhymes of Flute. beautbootbrutbrutebuttechutecootcuteflutefruithootjuteknoutlootlutemootmuterootroutescootshootsnootsootsuittootute. 41 Two-Syllable Rhymes of Flute. 29 Three-Syllable Rhymes of Flute. 4 Four-Syllable Rhymes of Flute.

What word rhymes with cup?

Words That Rhyme With Cup 1 Syllable Words That Rhyme With Cup. Coup. Krupp. Pup. Soup. Stupp. Sup. Up. Yup. 2 Syllable Words That Rhyme With Cup. Closeup. Workup.

What word rhymes with frog?

'frog' may also rhyme with: blog. · bog. · clague. · clog. · dague. · flog. · fog. · fogg. · frogg. · frogge… hog · dialog. hedgehog. · sledgedog. · log. · how many chucks could a wood chuck chuck if a wood chuck could chuck wood? blog. · bog. · clog. · cog. · dog. · fog. · hog. · jog. · log. · smog…

What word rhymes with ring?

Words that rhyme with "ring": 1 syllable: bing, ching, cling, ding, fling, ging, hing, ing, jing, king, kling, ling, lyng, ming, ning, ping, qing, schwing, shing, sing, singh, sling, sting, swing, thing, thwing, ting, tinge, wing, ying, zing. 2 syllables: beijing, chongqing, outsing, peking, unsling, upswing, xiaoping. Show Rare Words: Yes | No.

What word rhymes with pan?

Words That Rhyme With Pan 1 Syllable Words That Rhyme With Pan. An. Ann. Anne. Ban. Bann. Bean. 2 Syllable Words That Rhyme With Pan. Began. Bhutan. Cezanne. Chapin. Chauvin. Cheyenne. 3 Syllable Words That Rhyme With Pan. Anchorman. Ariane. Bogeyman. Boogeyman. Caravan. 4 Syllable Words That Rhyme With Pan. Assemblyman. Businessman. Catamaran. Minuteman. Newspaperman.

What word rhymes with map?

Rhymes with Map 23 One-Syllable Rhymes of Map. capchapclapcrapflapgaplaplappmapnapnapepaprapsapscrapslapsnapstraptaptrapwrapyapzap. 35 Two-Syllable Rhymes of Map. 5 Three-Syllable Rhymes of Map.

What word rhymes with milk?

What rhymes with "milk": bilk, ilk, silk, wilk, buttermilk, mi Pure Rhymes – 4 rhymes. bilk ilk silk wilk. End Rhymes – 1 rhyme. buttermilk. End Rhymes Set #1 of 1 (Add to/Edit Set Members) Near Rhymes – 2199 rhymes. milks silks. Dilks Wilkes. bilked milked. Near Rhymes Set #2 of 84 (Add to/Edit Set Members)

What word rhymes with block?

Rhymes with Block 40 One-Syllable Rhymes of Block. bachbalkblocblockbockcalkcaulkchalkchockclockcockcrockdocdockflocflockfrockgawkhawkhochockjockknocklocklockemachmockpockrockschlockshocksmocksocksquawkstalkstocktalkwalkwokyak. 77 Two-Syllable Rhymes of Block. 14 Three-Syllable Rhymes of Block. 1 Four-Syllable Rhymes of Block.

What word rhymes with rat?

Rhymes with Rat 29 One-Syllable Rhymes of Rat. atbatbattbratcatchatdratfatflatgnathatmatmattmattepatplatratsatscatscattskatslatspatsplatspratstattatthatvat. 24 Two-Syllable Rhymes of Rat. 21 Three-Syllable Rhymes of Rat. 2 Four-Syllable Rhymes of Rat. 1 Five-Syllable Rhymes of Rat.

What word rhymes with meat?

Rhymes with Meat 31 One-Syllable Rhymes of Meat. beatbeetbleatcheatcleatcreteeatfeatfeetfetefleetgreetheatmeatmeetmeteneatpeatpetepleatseatsheetskeetsleetstreetsuitesweetteattreattweetwheat. 55 Two-Syllable Rhymes of Meat. 15 Three-Syllable Rhymes of Meat.

What word rhymes with weak?

Rhymes with Weak 34 One-Syllable Rhymes of Weak. beakbleakcheekchiccliquecreakcreekekefreakgeekgleekgreekleakleekmeekpeakpeekpiquereekseeksheiksheikhshrieksikhsleeksneakspeaksqueakstreakteaktweakweakweekwreak. 18 Two-Syllable Rhymes of Weak. 4 Three-Syllable Rhymes of Weak. 1 Five-Syllable Rhymes of Weak.

What word rhymes with legs?

Words That Rhyme With Leg 1 Syllable Words That Rhyme With Leg. Beg. Cleg. Clegg. Eg. Egg. Gegg. Greg. Gregg. Keg. Kreg. Legge. Meg. Neg. Peg. Pegg. Preg. Reg. Veg. 2 Syllable Words That Rhyme With Leg. Manege. Muskeg. Segue.

What word rhymes with pen?

Words That Rhyme With Pen 1 Syllable Words That Rhyme With Pen. Been. Behn. Ben. Benn. Benne. Bren. Brenn. 2 Syllable Words That Rhyme With Pen. Aden. Adrienne. Again. Againe. Amen. Aren. Asean. 3 Syllable Words That Rhyme With Pen. Anchormen. Brakesmen. Comedienne. Councilmen. Equestrienne. Handymen. 4 Syllable Words That Rhyme With Pen. Businessmen. Minutemen.

What word rhymes with bone?

Rhymes with Bone 31 One-Syllable Rhymes of Bone. blownbonecloneconecronedroneflowngroangrownhonejoanknownloanlonemoanmownownphoneponeproneroansconesewnshoneshownsownstonethronethrowntonezone. 85 Two-Syllable Rhymes of Bone. 42 Three-Syllable Rhymes of Bone. 3 Four-Syllable Rhymes of Bone.

What word rhymes with care?

Rhymes with Care 41 One-Syllable Rhymes of Care. airbarebearblarecarechairdareerrfairfairefareflairflareglarehairhareheirlairmarepairparepearprayerquarerarescaresharesnaresparesquarestairstaresweartareteartheirtherethey'rewarewearwhere. 58 Two-Syllable Rhymes of Care. 32 Three-Syllable Rhymes of Care.

What word rhymes with King?

Words That Rhyme With King 1 Syllable Words That Rhyme With King. Bang. Being. Bing. Bling. 2 Syllable Words That Rhyme With King. Aching. Acting. Adding. Ageing. 3 Syllable Words That Rhyme With King. Anything. Huzzahing. Queering. 4 Syllable Words That Rhyme With King. Everything. Xiaoping. 5 Syllable Words That Rhyme With King. Deng xiaoping. Martin luther king.

What word rhymes with green?

There aren't many single syllable words to rhyme with green: bean, clean, dean, e'en (in a poetic context), gene, glean, jean, keen. lien, lean, mean, peen, preen, queen, seen, spleen, teen, 'tween (again, poetic), wean, ween (archaic)

What word rhymes with hug?

Rhymes with Hug 19 One-Syllable Rhymes of Hug. bugchugdougdrugdughugjuglugmugplugpugrugshrugslugsmugsnugthugtugugh. 7 Two-Syllable Rhymes of Hug. bedbugdebugearplugfireplughumbugsparkplugunplug. 7 Three-Syllable Rhymes of Hug. firebugjitterbugladybuglitterbugmealybugshutterbugtagalog.

What word rhymes with tie?

ai, aye, bae, bi, bligh, bly, blye, brye, buy, by, bye, cai, chae, chai, chi, chrie, craie, cry, crye, cy, dai, die, dry, drye, dye, eye, fae, fi, fly, flye, frei, fry, frye, fye, gae, guy, heye, heygh, hi, high, hsv-i, hy, hye, i, i., jai, kai, keye, kwai, lai, lcp fy, lie, ly, lye, mai, mei, my, nigh, nye, pae, phi,

What rhymes with the word sit?

Rhymes with Sit 29 One-Syllable Rhymes of Sit. bitbritchitfitflitgrithititkitknitlitmitmittnitpitquitsitskitslitspitsplitspritteattittwitwhitwitwritzit. 43 Two-Syllable Rhymes of Sit. 8 Three-Syllable Rhymes of Sit.

What rhymes with hip?

Rhymes with Hip 27 One-Syllable Rhymes of Hip. blipchipclipdipdripflipgripgyphipkiplipnippipquipripscripshipsipskipslipsnipstriptiptripwhipyipzip. 34 Two-Syllable Rhymes of Hip. 58 Three-Syllable Rhymes of Hip. 22 Four-Syllable Rhymes of Hip. 7 Five-Syllable Rhymes of Hip.

What rhymes with dip?

Rhymes with Dip 27 One-Syllable Rhymes of Dip. blipchipclipdipdripflipgripgyphipkiplipnippipquipripscripshipsipskipslipsnipstriptiptripwhipyipzip. 34 Two-Syllable Rhymes of Dip. 58 Three-Syllable Rhymes of Dip. 22 Four-Syllable Rhymes of Dip. 7 Five-Syllable Rhymes of Dip.

What rhymes with prunes?

Rhymes with Prune 18 One-Syllable Rhymes of Prune. booncooncroondunegoonhewnjuneloonlunemoonnoonprunerunesoonspoonstrewnswoontune. 41 Two-Syllable Rhymes of Prune. 12 Three-Syllable Rhymes of Prune. 1 Four-Syllable Rhymes of Prune.

What rhymes with June?

What rhymes with june? 1 syllable. Soon. Tune. Moon. Noone. Spoon. Goon. Boom. Doom. Room. Whom. Poon. Coon. Loon. 2 syllables. Fortune. Immune. Cartoon. Balloon. Bathroom. Bedroom. Typhoon. Monsoon. Assume. Cocoon. Harpoon. Baboon. Platoon. 3 syllables. Afternoon. Honeymoon. Opportune. Saskatoon. Tablespoon. Continuin' Autoimmune. Livingroom. Elbowroom.

What rhymes with mop?

What rhymes with "mop": bop, chop, cop, crop, drop, flop, glo Pure Rhymes – 61 rhymes. End Rhymes – 38 rhymes. Near Rhymes – 2077 rhymes.

What rhymes with Butters?

Words that rhyme with "butter": 2 syllables: clutter, cutter, dutter, flutter, frater, gutter, hutter, kutter, lutter, mutter, nutter, putter, rutter, schutter, scutter, shutter, splutter, sputter, stutter, sutter, utter. 3 syllables: aflutter. Show Rare Words: Yes | No. Show Phrases: Yes | No.

What rhymes with pig?

Words That Rhyme With Pig 1 Syllable Words That Rhyme With Pig. Big. Brig. Deg. Dig. Fig. Figge. Frig. Gig. Jig. Mig. Pigg. Prig. Rig. Rigg. Sig. Sprig. Sprigg. Stig. Swig. Tig. Trig. Twig. Vig. Whig. Wig. Zig. 2 Syllable Words That Rhyme With Pig. Config. Rejig. Renege. 3 Syllable Words That Rhyme With Pig. Whirligig. 4 Syllable Words That Rhyme With Pig. Thingamajig.

What rhymes with Belle?

Rhymes with Belle 22 One-Syllable Rhymes of Belle. bellbellecelldelldelledwellellfellgelhelljellknellpellquellsellshellsmellspellswelltellwellyell. 54 Two-Syllable Rhymes of Belle. 20 Three-Syllable Rhymes of Belle. 2 Four-Syllable Rhymes of Belle.

What rhymes with hogs?

Words that rhyme with "hog": 1 syllable: bog, clague, clog, dague, dog, fog, fogg, frog, frogge, grogg, jog, krog, lague, log, maag, mogg, plog, prague, rogge, skog, slog, smog, tague, waag, zogg. 2 syllables: 3 syllables: 4 syllables: 5 syllables: 6 syllables:

What rhymes with can?

Words That Rhyme With Can 1 Syllable Words That Rhyme With Can. An. Ann. Anne. Ban. Bann. Bean. 2 Syllable Words That Rhyme With Can. Began. Bhutan. Cezanne. Chapin. Chauvin. Cheyenne. 3 Syllable Words That Rhyme With Can. Anchorman. Ariane. Bogeyman. Boogeyman. Caravan. 4 Syllable Words That Rhyme With Can. Assemblyman. Businessman. Catamaran. Minuteman. Newspaperman.

What animals rhyme with dog?

Rhymes with Dog 16 One-Syllable Rhymes of Dog. bogclogcogdogflogfogfroggroghogjoglognogpragueslogsmogtog. 19 Two-Syllable Rhymes of Dog. backlogbefogbird-dogbulldogbullfrogdefogeggnogfiredoggroundhoghangdoghedgehoghot-doglapdogleapfrogprologuesandhogsheepdogunclogwatchdog. 20 Three-Syllable Rhymes of Dog.

What rhymes with used to it?

Words that rhyme with "used": 1 syllable: bruised, cruised, fused, mused, oozed. 2 syllables: abused, accused, amused, bemused, confused, defused, diffused, enthused, excused, infused, misused, perused, recused, refused, reused, suffused, transfused, unused. 3 syllables: overused, underused. Show Rare Words: Yes | No. Show Phrases: Yes | No.

What Rhymes With Frog and dog?

Rhymes with Frog 16 One-Syllable Rhymes of Frog. bogclogcogdogflogfogfroggroghogjoglognogpragueslogsmogtog. 19 Two-Syllable Rhymes of Frog. backlogbefogbird-dogbulldogbullfrogdefogeggnogfiredoggroundhoghangdoghedgehoghot-doglapdogleapfrogprologuesandhogsheepdogunclogwatchdog. 20 Three-Syllable Rhymes of Frog.

What rhymes with cat and hat?

Rhymes with Cat 29 One-Syllable Rhymes of Cat. atbatbattbratcatchatdratfatflatgnathatmatmattmattepatplatratsatscatscattskatslatspatsplatspratstattatthatvat. 24 Two-Syllable Rhymes of Cat. 21 Three-Syllable Rhymes of Cat. 2 Four-Syllable Rhymes of Cat. 1 Five-Syllable Rhymes of Cat.

Does dog rhyme with log?

"Can anyone name two words that rhyme?" asked the teacher. debate amongst her family about whether dog and log do, in fact, rhyme. when you tried to suggest that dog and log rhyme. of the red one in the map above)—uses approximately an /ɔ/ in dog but an /ɑ/ in log.

What words end with IX?

8-letter words that end in ix appendix. crucifix. intermix. aviatrix. cicatrix. transfix. coturnix. mirepoix.

What are words with X?

X words - Words with letter X 2 letters. AX EX OX XI XU. 3 letters. AXE BOX COX DEX DUX EXO FAX FIX FOX GOX HEX HOX KEX LAX LEX LOX LUX MAX MIX MUX NIX NOX OXO OXY PAX PIX POX PYX RAX REX SAX SEX SIX SOX TAX TEX TIX TUX VEX VOX WAX WEX WOX XIS YEX ZAX ZEX XED. 4 letters. 5 letters. 6 letters. 7 letters. 8 letters.

What words end with X?

9-letter words that end in x metroplex. multiplex. letterbox. heterodox. neocortex. tinderbox. strongbox. executrix.

What words can you spell with Z?

OSPD 3- to 5-Letter Words With a Z in the Official Scrabble Players Dictionary (as of 2-Mar-98) These are the 4-letter words which include the letter Z:ADZEDAZELAZEAZANDITZLAZYAZONDOZELUTZBIZEDOZYMAZE6 autres lignes • 14 déc. 2012

What words that start with J?

13-letter words that start with j justification. juxtaposition. jurisprudence. jollification. justificative. justificatory. jurisdictions. jurisconsults.

What are words beginning with X?

9-letter words that start with x xenograft. xylophone. xeroderma. xenophobe. xenophile. xenocryst. xylograph. xenoblast.

Who invented water clocks?

Ctesibius invented an indicator system typical for later clocks such as the dial and pointer. The Roman engineer Vitruvius described early alarm clocks, working with gongs or trumpets. A commonly used water clock was the simple outflow clepsydra.

What rhymes Hut?

What rhymes with "hut": but, butt, cut, glut, gut, gutt, haut "Go Pro" to see the next 79 end rhyme sets.

What rhymes bark?

Words that rhyme with "bark": 1 syllable: arc, ark, cark, chark, clark, clarke, dark, darke, hark, harke, karch, lark, larke, marc, mark, marke, marque, narc, parc, park, parke, sark, shark, sparc, spark, starck, stark, starke, wark. 2 syllables: demark, impark, premark, remark, remarque. 3 syllables: countermark, intermark. 4 syllables: mediamark.

What rhymes w cute?

Rhymes with Cute 26 One-Syllable Rhymes of Cute. beautbootbrutbrutebuttechutecootcuteflutefruithootjuteknoutlootlutemootmuterootroutescootshootsnootsootsuittootute. 41 Two-Syllable Rhymes of Cute. 29 Three-Syllable Rhymes of Cute. 4 Four-Syllable Rhymes of Cute.

What rhymes mute?

Rhymes with Mute 26 One-Syllable Rhymes of Mute. beautbootbrutbrutebuttechutecootcuteflutefruithootjuteknoutlootlutemootmuterootroutescootshootsnootsootsuittootute. 41 Two-Syllable Rhymes of Mute. 29 Three-Syllable Rhymes of Mute. 4 Four-Syllable Rhymes of Mute.

What rhymes quit?

Rhymes with Quit 29 One-Syllable Rhymes of Quit. bitbritchitfitflitgrithititkitknitlitmitmittnitpitquitsitskitslitspitsplitspritteattittwitwhitwitwritzit. 43 Two-Syllable Rhymes of Quit. 8 Three-Syllable Rhymes of Quit.

What rhymes met?

Rhymes with Met 16 One-Syllable Rhymes of Met. betdebtfretgetjetletmetnetpetsetsweatthreatvetwetwhetyet. 63 Two-Syllable Rhymes of Met. 38 Three-Syllable Rhymes of Met. 1 Four-Syllable Rhymes of Met. 2 Five-Syllable Rhymes of Met.

What rhymes ant?

Rhymes with Ant 12 One-Syllable Rhymes of Ant. antauntcan'tcantchantgrantpantplantrantscantshan'tslant. 19 Two-Syllable Rhymes of Ant. askantaslantdecantdescanteggplantenchantextantgrandaunthouseplantimplantpieplantrecantregrantrembrandtreplantsavantsecantsupplanttransplant. 2 Three-Syllable Rhymes of Ant. disenchantgallivant.

What rhymes wash?

Rhymes with Wash 10 One-Syllable Rhymes of Wash. boshfroshgoshjoshposhquashsloshsquashswashwash. 13 Two-Syllable Rhymes of Wash. awashbackwashbrainwashcarwasheyewashgaloshgoulashhogwashkiboshmouthwashpanacheprewashwhitewash. 1 Three-Syllable Rhymes of Wash. mackintosh.

What is the clock pendulum for in Resident Evil 7?

The Pendulum is one of the Key Items in Resident Evil 7 Biohazard. It is an object used to obtain one of the Dog's Head Keys in the Main House.

What's a 3 letter word that starts with X?

3 Letter X Words WordScrabble® PointsWords with Friends® Pointsxii1010xis1010xli1011xia101013 autres lignes

What are 4 letter words that start with Z?

zags. zany. zaps. zarf. zeal. zebu. zeda. zeds.

What are positive words that start with J?

Starting with JO jocose. jocular. jocund. joking. jolly. jovial. joyful. joyous.

What does the word s * * * * * * mean?

Shit is a word generally considered to be vulgar and profane in Modern English. As a noun, it refers to fecal matter, and as a verb it means to defecate; in the plural ("the shits"), it means diarrhoea. Shite is a common variant in British and Irish English.

Do rhymes?

Words That Rhyme With Do 1 Syllable Words That Rhyme With Do. Bleu. Blew. Blue. Boo. Brew. Bu. Chew. Choo. 2 Syllable Words That Rhyme With Do. Accrue. Achoo. Ado. Anew. Askew. Babu. Baku. Ballou. 3 Syllable Words That Rhyme With Do. Adieu. Atishoo. Avenue. Ballyhoo. Bienvenue. Buckaroo. Bugaboo. 4 Syllable Words That Rhyme With Do. Depardieu. Hullabaloo. Kalamazoo. Muumuu.

What words have Z?

OSPD 3- to 5-Letter Words With a Z in the Official Scrabble Players Dictionary (as of 2-Mar-98) These are the 4-letter words which include the letter Z:ADZEDAZELAZEAZANDITZLAZYAZONDOZELUTZBIZEDOZYMAZE6 autres lignes • 14 déc. 2012

What words cause Iphone effects?

9 GIFs Showcasing Every New iMessage Bubble Effect in iOS 10 Slam. The Slam effect aggressively plops your message on screen and even shakes the previous conversation bubbles for effect. Loud. Gentle. Invisible Ink. Balloons. Confetti. Lasers. Fireworks.

What is knowledge simple words?

Knowledge means the things which are true, as opposed to opinion. Information which is correct is knowledge. Knowledge can refer to a theoretical or practical understanding of a subject. This was the point of Ryle's distinction between "knowing that" and "knowing how".

Is there a word with all 26 letters?

I doubt there is a single word in the English language that includes all 26 letters, but the following sentence does: The quick brown fox jumps over the lazy dog. An individual character from an alphabet is a “letter”.

How many words start with the letter X in English?

The dictionary on this website, which covers today's English, contains about 120 words that start with 'x', from X itself (a noun which, among other things, is used to refer to an X-shape) toxystus (a long portico in which athletes used to exercise in ancient Greece).

What does dog and bone mean in cockney rhyming slang?

Dog and Bone is Cockney Rhyming Slang for Phone!

What does bird mean in cockney rhyming slang?

Bird is Cockney Rhyming Slang for A woman.!

What words do dogs understand?

According to experts, intelligent dogs can learn around 165 words. But spoken language isn't the only means by which our dogs try to understand us. Dr. Stanley Coren, a psychologist and an expert on dog intelligence, says the average trained dog knows about 165 words.

What words end in EZ?

3-letter words that end in ez fez. lez. sez. mez. kez. rez. pez. nez.

What word ends in F?

10-letter words that end in f waterproof. soundproof. cloverleaf. stroganoff. childproof. flameproof. shockproof. hippogriff.

What Words Can dogs understand?

Dogs do not understand English or any other human-created language. They do understand words (or rather, sounds) in any language. After hearing “sit” many times, the dog associates it with a particular behavior and with some consequences; and will end up sitting more often than not when it hears that sound.

What words end in ex?

5-letter words that end in ex index. annex. latex. telex. codex. culex. silex. murex.

What words end in Dex?

5-letter words that end in dex index. codex. fedex. videx. medex. redex. lidex. apdex.

What is a marker word?

A marker word is a word, noise or signal that you choose to mark or highlight the behavior you desire in your dog, as your dog does it. It remains consistent throughout your dog's life that means a treat/reward is on its way. Just as the marker word, it too remains consistent throughout your dog's life.

What's another word for puppy?

puppy animal. dog. pup. canine. coxcomb. dandy. fop. whelp.

What does Jack and Danny mean in cockney rhyming slang?

jack and danny [Br.] [ cockney rhyming slang: fanny] [Cockney Rhyming Slang für: Vagina] back to top | home.

What does Kermit mean in cockney rhyming slang?

Kermit is Cockney slang for Road.

Is the S word a bad word?

Profanity means swear words. The adjective is 'profane'. Profanities can also be called curse ("cuss") words, dirty words, bad words, foul language, obscenity, obscene language, or expletives. It can be called swearing, although this also has a normal meaning of making a "solemn promise".

What words have Z at the end?

3 Letter Words adz. bez. biz. caz. coz. cuz. fez. fiz.

What is another word for canine?

hound, puppy, canine, mongrel, cur, canis familiaris (Latin), bitch, pup, whelp, stray, watchdog, lap dog, guide dog, Seeing Eye dog, pye-dog, pooch*, mutt*, bowwow*, Fido*, fleabag*.

What is another word for puppies?

puppy animal. dog. pup. canine. coxcomb. dandy. fop. whelp.

What is the Scottish word for dog?

Loch – the Scottish Gaelic word for a lake. Haggis – a traditional Scottish dish.

What is another word for cow poop?

Cow dung, also known as cow pats, cow pies or cow manure, is the waste product of bovine animal species. These species include domestic cattle ("cows"), bison ("buffalo"), yak, and water buffalo. Cow dung is the undigested residue of plant matter which has passed through the animal's gut.